PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01188.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MYB
Protein Properties Length: 1750aa    MW: 191979 Da    PI: 5.7531
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01188.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.56.4e-08927968346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e+++   +  G++ +++Ia+ +  ++t  +c+++++k
    Jcr4S01188.20 927 PWTLEEREIFISKLTTIGKD-FRKIASFLD-HKTTADCVEFYYK 968
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding31.93.2e-1011401180345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                        WT eE  ++++av  +G++ ++ I+r++  +R++ qck ++ 
    Jcr4S01188.20 1140 DWTDEEKSIFIRAVSSYGKD-FAMISRCVR-TRSRDQCKVFFS 1180
                       6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.68E-13911971IPR009057Homeodomain-like
PROSITE profilePS5129313.052923974IPR017884SANT domain
SMARTSM007174.0E-7924972IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-5927968IPR009057Homeodomain-like
PROSITE profilePS5129311.57211361187IPR017884SANT domain
SMARTSM007179.7E-911371185IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-1011391187IPR009057Homeodomain-like
PfamPF002499.0E-811401180IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-611401181IPR009057Homeodomain-like
CDDcd001672.00E-711411179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1750 aa     Download sequence    Send to blast
MPPERLPWDR KEFFKDRKPD RSTPRWRESS SSHYGSSRDF SRWGGSNEFR RPPVGFLRQM  60
EEILLGIIPL ITAIHKVAIS GLSKIFGDML MSGVHSNLXS GTYLLSMVSR GGWHLFAEES  120
SRGYAPFRSN DRILEDKNYR PSVSRGDGKY GRNSRDNRGS FSSQRDWKAH SWEMSNGSPS  180
TPGRLHDAAN DQRSVDDMLT YPPSHSRSEL GNKWEHLHPK DQHDNIKAAG VSAVGTGQRG  240
DRESSLDWKP LKWDRSGSLS SRGSGFSHSS SSKSIGGGDS SEGKADMQLK SASIVQSPSG  300
DAAACVTSAP SEDMSSRKKP RLNWGEGLAK YEKKKVEGPE MNVIKDEPVI YCINIEPIHS  360
QSSNLVDKSP RVLGLSDCAS PATPSSVACS SPGVEEKTLG KGVNVDNDVG NLCGSPSFGS  420
QTNNEGLSFN LEVLDATSIS NLGASLVELL QSDDSSSVDS SFVRSTLINK LHMLKGDISK  480
ALEVTESEID SLESELKLLK FEPGSMYPGP AASSFFQAVN DAKPCSEQGA VSNDIPRSSP  540
LHVMASGSGQ VENSSLDDGV LEEVNVAIKD DDVDSPGTAT SKFVEPLSVV KMVSSSDMVK  600
LDHCSGDIGV LRIQTMALKP CVPYTNKEDD NCAACGDVSM LIESKDVVPF PSDVSFAEDN  660
LCNLILAANK ESANRASEEL STLLPRDQCK VDVSEVSNAA LWKADALIKE KFAMRKRFLR  720
FKDRVVTLKF KAFQHLWKED MRLLSVRKYR AKSQKKYELS LRTTHSGCQK NRSSIRTRFS  780
SPDSLENLIQ KMSFMFGILF DMHLKLVWSL DLVIEFLCAV MECQMHDCSA GAHCMWPSEY  840
DVEFDYALGL VMLSSRVGNL SLVPTTEMLN FTSKLLSVSQ NKLYRNALKM PALILDKKER  900
MVSRFVSSNG LVEDPCAVEK ERAMINPWTL EEREIFISKL TTIGKDFRKI ASFLDHKTTA  960
DCVEFYYKNH KSDCFEKTKK SKKVKSSTNY LMSSGKNWNR EMNAASLDIL GAASVIAADA  1020
DNSMGNRQMC SGRIYYGGYC ESKIPHGNDG NLDRSSNFDV LENERETAAA DVLAGICGSM  1080
SSEAMSSCIT TSVDPGEGCR EWKSQKVDSV KKRPSTSDVT QNVDEDTSSD ESCGEMDPSD  1140
WTDEEKSIFI RAVSSYGKDF AMISRCVRTR SRDQCKVFFS KARKCLGLDS IHPAPGNLGT  1200
PVSDDANGGG SDTEDGCALE TGSVICSDKL GSKTDEDLPL PVIDAKHEKS NAAERENVTA  1260
DLNNPKESNV ARSLEQNDSK DEISFVSDAC KMGDKSELAF EIDTHQSEVG QAQEISNESV  1320
NSESKRDKPI EHSTSVGEPM YVDAADPGPL NPVSGIELKV IAEVAANGSA NHVEQKEVLL  1380
PENNSNFSVN VENIHHVSGE FDSVAESPTV SLPQENNIAS GAPMLQDTVS IQCERMHTHE  1440
NRDGQGKESG SGDDHLQHPP GKSLVNCSES LQILRGYPLQ IPTKKEMNGD ISCGLLSEVQ  1500
KSFSTSDYYL QKCNSSSKTQ SSLPELPLLS KHAEHGNDHS RDHSRSLSDT EKPCRNVIIL  1560
AFENVPVKSY GFWDGNKIQT GFSSLPEYFL AKYPAAFSNY HVSSSKMEQQ ALQAAVKCND  1620
RNLNGVSVLP PREVSGSNGV VDYQMYKSHD NSKVQPFSVD MKQRQDIFSE IQRRNGFEAI  1680
SSLQQQGRGV VGMNVVGRAG ILVGGSCTGV SDPVAALKMH YAKTEQFSGQ NGAAIIREEE  1740
SWRSKGDIGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D7e-14885976494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C7e-14885976494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086506.10.0PREDICTED: uncharacterized protein LOC105645502
TrEMBLA0A067K1T60.0A0A067K1T6_JATCU; Uncharacterized protein
STRINGPOPTR_0010s22670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-99MYB family protein